PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr6g092540.1
Common NameMTR_6g092540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 290aa    MW: 31857.7 Da    PI: 9.207
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr6g092540.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73e-1498142347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + ++lG+g+W+ I+r   ++Rt+ q+ s+ qky
  Medtr6g092540.1  98 PWTEEEHRKFLVGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKY 142
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.532318IPR001878Zinc finger, CCHC-type
Gene3DG3DSA:4.10.60.107.8E-4327IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.97791147IPR017930Myb domain
SuperFamilySSF466898.22E-1892146IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-1894145IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.9E-1195141IPR009057Homeodomain-like
SMARTSM007173.1E-1195145IPR001005SANT/Myb domain
PfamPF002497.1E-1298142IPR001005SANT/Myb domain
CDDcd001675.23E-1098143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MGRKCSHCGN IGHNSRTCNS LRGSGSFVGV RLFGVQLDLS SSCVSMKKSF SMDSFPTSSS  60
SPTSSFSSSR LTIDDRASIG YLSDGLIVRT QERKKGVPWT EEEHRKFLVG LEKLGKGDWR  120
GISRNYVTTR TPTQVASHAQ KYFIRLATLN KKKRRSSLFD MVGSGKTNKT VDPNNSSKSK  180
SGDSVCRHDH EVEKDATLSL LINSLQQQTK SDDYDMQKIE DDSEEAEHKD VPDWLHPLTK  240
SLNMTLVIPN SSNVAPPDLE LTLAGSKSNN MEQDKTSSSS FLIGPISVT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150154KKKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.164970.0root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1480620.0BT148062.1 Medicago truncatula clone JCVI-FLMt-15G22 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003620926.10.0MYB-like transcription factor family protein
TrEMBLG7KJT90.0G7KJT9_MEDTR; MYB-like transcription factor family protein
STRINGGLYMA08G03330.12e-94(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.11e-55MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]